Svg map generator. Any use, including commercial, is allowed.
Svg map generator random ideas, by Jérôme Muffat-Méridol Laser Map Maker is the next-gen platform for effortless vector map creation. Analyze customer and employee feedback. net, your go-to solution for creating high-resolution printable maps. Create futuristic SVG maps, Tron-like, filled with dots or hexagons - NTag/dotted-map Image Map Pro™ comes with its own feature rich web app, that is light years head of the competition. Color an editable map and download it for free to use in your project. Please note, as for now, the drawing below is square and you may want to stretch it to cover the actual area in a map. Transform any image into scalable vector graphics using AI. Oct 1, 2024 · Trying to create a topographical map with vector-based contour lines? This guide will show how to export an SVG in Maperitive to Inkscape. In this guide, we will walk through creating a number of Strip Maps for real world transit networks. com is #1 provider of free vector maps. . Just start typing the name of the country and choose an SVG file: When you open the drop-down list with SVG files, you'll see that each file is located by one of the following 3 paths: geo-calibrated/: calibrated maps. You'll see Import maps as vector layers, with local styles for further customization. AI’s Online Map Maker. The contour line image will redraw to match the area you choose. These plugins let you work with maps directly in Figma Design, eliminating the Learn how to create high resolution custom Google maps in under 5 minutes. Add Google Maps with a couple of clicks, generate vector maps of countries and regions, or create custom street layouts. First-level administrative regions identified by name and id in the source code. A cartography tool for designers by Evan Applegate. In no time at all, you will have enhanced your website with a beautiful, fully customizable, interactive map. Big thanks to dlicacy. Our free platform with unlimited access allows you to design various custom vectors with just a few mouse clicks. 🗃️ Visibility 2 items 🗃️ Regions 5 items 🗃️ Database 5 items 📄️ Actions In this tab you can choose what actions should be performed on click on a Region, Marker and Directory item. Say goodbye to grainy bitmap images and hello to beautiful web graphics for any purpose — from logos to branded icon sets. Download free, web-optimized SVG maps of countries and continents for personal and commercial use. Our tool supports various formats, including topographic SVG and maps with contour lines, making it ideal for personalized topographic maps, custom topo maps, and more. Find & Download Free Graphic Resources for World map svg Vectors, Stock Photos & PSD files. png Download a heightmap as a . Together with the example networks that showcase what this software is capable of, this user guide should provide sufficient guidance and examples for using the software. g. Find and download free SVG maps for non-commercial use from amCharts. Create interactive vector maps of the world, continents, any country in the world and specific regions, including individual US state county maps. png Download the map as a . High-Quality Output: Our tools generate high-quality files in SVG, PNG, or PDF format, which are perfect for professional and personal use. Our topographic map generator is designed to create detailed topographic maps with contours. Click on "Edit SVG file" button in the top toolbar. LLM + D3. Secure and Private: We prioritize your security and privacy. Create personalized and detailed maps with Edraw. Download layered SVG and PSD maps, optimal for Illustrator and Photoshop. Turn simple images and vector graphics into high quality, responsive and fully interactive maps. Cadmapper lets anyone create 3D CAD files of any area in the world within minutes. Identify SEO terms and keywords. It was created with the needs of designers and data journalists in mind. Instantly download precise 2D maps and 3D models for architecture and urban planning. Cherry on top - IT'S FREE! A quick and easy way to create a custom vector map in Illustrator using Google Maps. com, who got me started on the idea. The OpenMapTiles vector tile schema is open source and licensed under BSD + CC-BY. js bundle for embedding. svg Download the 3D model as a . Print-ready vector files Whether you’re designing maps for real estate, news, TV or web, create professional-grade print-ready vector files. Screenshot of Adobe Illustrator showing a Maperitive-generated SVG map. A tool to easily create OpenStreetMap SVG maps to plot them Create a stunning interactive maps with simple-to-use user interface. Commercial use is allowed. You can customize your maps by binding data, adding fonts, drawing choropleth, and optimizing the SVG file size. Formats: DXF, IFC, OBJ, STL. It will give us a crisp looking map at likely a reasonable size, and most importantly, give us the interactivity and easy styling we need. This can either be used as an API or downloaded, printed, and hung on your wall. Visualize data on a color coded map chart, add pins, import data from Excel and download or share for free. Choose your style, custom text, size and night sky. Make a walking map, a city map, a National Park map, a cycling map. Free web app that helps fantasy writers, game masters, and cartographers create and edit fantasy maps CARTOGRAPHER uses VERTEX to create a vector map of the selected area completely automatically. Map Maker Online - Create stunning custom maps with MakeMyMap, the ultimate online map creator. Generate Earth maps using Waterman Butterfly projection (WB) Support for multiple Natural Earth datasets (50m and 110m resolution) Command-line interface for easy map generation Configurable projection parameters SVG output format Transform any image into scalable vector graphics using AI. Creating a new SVG map Open MapSVG and click on "New SVG map" drop-down. You can easily customize vector components including your promoter, ORF, and marker by selecting from our database or pasting Creating a vector graphic with Recraft's AI image vectorizer is easy. Transform data into insights with our Free Word Cloud Generator. Press the rectangle button, select a rectangle on a map and wait. Discover more than 1200 maps. Use reactive JavaScript notebooks for prototyping and a collaborative canvas for visual data exploration and dashboard creation. Generation of vector maps from OpenStreetMap data. Upload your data, visualize regions, and export high-quality maps in JPG, PNG, PDF, and editable vector formats. If you see that the country you need is present in both geo See Maperitive In Action! Hiking Web map hosted on MapBox Oxford Bus & Cycle Map Maperitive Flickr photostream Features text-based stylesheets web tiles generator supports MBTiles from MapBox generates relief contours with labels hillshading and elevation coloring export to PNG, JPG & others export to SVG (Inkscape, Adobe Illustrator) command-line headless console GPX support OSM web maps Download for free blank SVG vector map of World and use it in any mapping project. Backbone vector selection: Click on the icon on the left side of the panel, there will be a search box, a list of host cell type list, and a text box. DESIGNED FOR ANY PURPOSE: Create your own isometric city map and room within minutes Over 530 isometric map elements• 730 Isometric room elements • Scalable vector format • Free updates and support. Swiss Maps Generator A free tool to generate TopoJSON or SVG from Swisstopo geodata. Create custom maps in WordPress from any source - SVG file or jpeg/png image, Google Maps. It's completely free (no signup) and uses the Stable Diffusion text-to-image model. Or import as image for quick prototyping. Visualize geographical data, plan routes, or design custom layouts with AI-powered tools—right in your browser. Choose the file from your local disk. Use our height map generator and map contour lines features to visualize your data. Quickly and easily create engaging interactive experiences with custom vector shapes, pins and tooltips, and customise styles to fit your design. Mapcreator was designed to make mapping fast Fast and Free: Our builder/generator tools run on the client-side, which means you can generate your files quickly and for free. Convert your images to SVG format with our free online tool. Welcome to Printmaps. An easy, powerful, and intuitive mapping tool for your business Mapcreator is a mapping tool that makes the daily tasks easier for thousands of professionals around the world every day. Use it to create graphic designs and edit SVG content. XML & XSLT pages contain closely related matters. To demonstrate, a US map that includes the National Parks is created. Go from PNG or JPG to SVG online in a few clicks. Create multi-layered maps with ease that are ready to cut and engrave in minutes. Our map generator tools offer a wide range of capabilities, including contour maps and topography svg generation. Choose the color of the map, the color and thickness of the borders, and download a vector SVG file. In this article Chris Youderian will explain how to create your own SVG maps using Natural Earth data and open source tools. SVG Map Generator A React application that enables non-technical team members to create SVG coverage maps. Also available are outline and black-and-white World map templates in SVG and PDF format. Use this tool to generate static SVG images of maps that you can then include in your web pages and documents. Interactive SVG Map is a powerful JavaScript tool that transforms any SVG file into an interactive and fully customizable map or floorplan. An online Editor to create stylish world or country maps inlcuding heat-maps, pixelated visuals. js lets you create an interactive, SVG powered world map on the webpage, with support for Info Window which can be used to present any data when the user hovers over a specific country and region. Welcome to the user guide for the SVG Strip Map Generator. Convert PNG, JPG to SVG with multiple artistic styles. See also other map styles, allowing generation of other maps from the same OpenStreetMap data. You'll be redirected to the next screen with the map editor. Other mapping tools are cumbersome and complex to use. Just be sure to credit OpenStreetMap and its contributors! SVG Strip Map Generator Welcome to the website for this project - a SVG and JSON-based Strip Map Generator. And we don't even collect your data! With tilemaker, you can pull out any facet of OpenStreetMap's rich data. This project aims to provide a way to generate strip maps from JSON stored in a standard JavaScript file, with no need for a vector graphics editor such as Adobe Illustrator or Inkscape (though those tools are, of course, much more powerful). Let’s use a state map of the United States as an example. If you open the list of Regions you'll see that it's empty. With a vast library of over 180 built-in geo-calibrated SVG maps, users have access to a wide range of options to suit their specific needs and preferences. Recreate the real position of the stars given a location and date. Our SVG’s are layered just like our elements list – use Mapcreator as a starting point for your personalized map design and delegate further development to your design team. Actually, Kartograph is two libraries. Plus, some more color tools for web designers. Select any location on the map to generate detailed vector maps perfect for laser cutting. Any use, including commercial, is allowed. Simply open the editor and select a size for your design canvas. Guides Map editor Map editor 📄️ Overview 1 🗃️ Filters 2 items 📄️ Settings This tab contains main options and those groups of options that didn't get their own screen. These maps are vectorised, allowing you to edit each path in Adobe Illustrator and GPS Visualizer is a free utility that creates customizable maps and profiles from GPS data (tracklogs & waypoints), addresses, or coordinates. There's no magic to it, just photoshop and illustrator elbow grease. Use the Lua scripting language to select OSM tags and encode them into vector tile values. Perfect for designing location-based features, regional data visualizations, or any project needing geographic context. Free for commercial use High Quality Images May 22, 2024 · topoBuilder is a public web application released by the National Geospatial Program that enables users to request customized USGS-style topographic maps, known as an OnDemand Topo, that utilize the best available data from The National Map. MapCrate uses data from OpenStreetMap. Generate AI fantasy map images from text. Make your Flight Plan at SkyVector. Flight planning is easy on our large collection of Aeronautical Charts, including Sectional Charts, Approach Plates, IFR Enroute Charts, and Helicopter route charts. Easy-to-use converter supporting PNG, JPG, and GIF files. Exportable to images or interactive embeddable code. You will then #1 Source Of FREE Online Vector Designing Apps, Mockups, Templates, And More. Generate world maps, challenge viewpoints and export your vector data! Up-to-date maps in vector format for web or mobile, for self-hosting or offline use. The scalability, small file size, and accessibility of SVG images make this format Vemaps. Free Star Map Generator. SVG stands for S caleable V ector G rapics. You are free to use it to generate your own OpenMapTiles and use those vector tiles afterward. A quick, simple tool for creating, viewing, and sharing spatial data. City plans. With just one click. However, you are still obliged to follow original ODbL license and attribute OpenStreetMap data properly as well as attribute the OpenMapTiles project itself. Get high-quality vector graphics instantly. Aug 23, 2025 · The svgMap. Whether you’re designing custom maps for travel guides, real estate brochures, or route maps, our online map editor makes it easy to create print maps in multiple formats such as SVG, PSD, or PNG. Vectordad. One generates beautiful & compact SVG maps; the other helps you to create interactive maps that run across all major Create vector dotted maps with custom options and download them as SVG or PNG files Download any map for free to include in your data project Quadrigram's choropleth maps work with SVG files. Mapcreator lets you create custom vector maps in minutes with data, colors, styles, and more. Contour Map Generator outperforms traditional methods in cost, speed, and quality—using a whole-systems approach to deliver comprehensive, actionable insights in minutes, not months. Sometimes, there will be a nice, vector map Download thousands of free vector maps, royalty free maps, world maps, us maps, map bundles in Adobe® Illustrator, Microsoft PowerPoint®, EPS, PDF, PNG and JPG formats. Almost certainly, they use a scan of a street map, and then pull the roads out by color, and then autotrace, cleaning up where needed. Download SVG View Source GIS Customize Online as Interactive Map Make this India map interactive and customize it online! Our software turns this static SVG map into a zoomable, clickable, mobile-friendly map like the one below. Or, you could try searching your city sites for PDF files about new roads, or other infrastructure announcements, or planning documents, etc. You need to draw some vector shapes that will be interactive. Wikipedia has a perfect one for us to 3 days ago · VectorBuilder offers a highly innovative web-based platform that combines sophisticated yet intuitive vector designing with streamlined online ordering. CartoSVG lets you design interactive maps with various features and effects. From managing stormwater and flood risk to planning your home, driveway, gardens, and solar panels, it simplifies complex decisions so you can design with Nov 5, 2025 · Mapplic is the #1 custom map WordPress plugin on the web. Save it as image or JavaScript code for easy publishing on your own website. Great tool for 3D printing, 3D modeling, bas-relief design. Contact Keir - @probabletrain Free Topography SVG Generator This Contour Topography SVG Generator is a specialized free tool designed to create detailed topographic maps with custom contour lines. Uncover trends and patterns to gain insights from your text data. a) From the Download for free blank SVG vector map of Vietnam and use it in any mapping project. Find the perfect map for your project with plugins from the Figma Community. High-quality vector tiles from OpenStreetMap data in MBTiles format. Become a channel member:more First-level administrative regions identified by name and id in the source code. The screen will change to "Drawing mode". Jan 26, 2017 · Doable! First, the map should probably be vector. Flexible tag processing with Lua Simplify and filter by zoom level Add external shapefile data Compact AI relief generator. Easily create stunning, visual maps and guide people to where they need to go. 1. Or just use the pre-prepared scripts shipped with tilemaker. Design custom maps with Canva’s free online map generator. Mar 9, 2023 · SVG, or Scalable Vector Graphics, is a versatile image format that you can use in a wide range of applications, from web design to print media and data visualization. Commercial use allowed. Getting Started NovoBuilder is a free, online tool for molecular biology that integrates plasmid sequence annotation, plasmid design, map presentation (support Genbank and Snapgene format), codon optimization, and automatic quote. You'll see a list of all available maps. AI-powered text-to-map maker. Snazzy Maps is a repository of different color schemes for Google Maps aimed towards web designers and developers. With tilemaker, you can pull out any facet of OpenStreetMap's rich data. Its intuitive interface and iterative improvements made it a valuable time-saving tool for various team members, while enhancing accessibility for all users. Flexible tag processing with Lua Simplify and filter by zoom level Add external shapefile data Compact A free, web-optimized, SVG world map using the beautiful Robinson projection. How to create an image map Open MapSVG and click on "New Image map". Trusted by over 10,000 companies worldwide, our platform enables you to design and download printable maps Save Contour Map as an SVG file If you want to have the contour maps as an individual layer (e. Laser Map Maker is the next-gen platform for effortless vector map creation. Sep 9, 2015 · Interactive maps can be intimidating, but they don’t have to be a black box. Uses the beautiful Mercator Projection. Weather data is always current, as are Jet Fuel Prices and Avgas 100LL prices. Create custom QR Codes with Logo, Color and Design for free. Create custom maps with Printmaps, the online vector map maker. Creators are free to copy, distribute, transmit, and adapt the data. Choose from high and low details, and customize them with amCharts 5 dataviz library. 📄️ Laser Map Maker is the next-gen platform for effortless vector map creation. com is the home of hundreds of Online Vector Designing Apps for Cricut, Silhouette users, Laser Cutters, and Printers. Create a personalised Star Map poster, download as a high-quality Png or Svg, for free. Choose from buildings, roads, railways, water features, and more. Our tool is packed with features to help you create high-quality vector maps that are ready for print. It allows users to generate and export scalable free vector graphic (SVG) files, which are ideal for various design projects. Generation of vector maps from OpenStreetMap data, for use in laser cutters for producing tactile maps. This QR Code Maker offers free vector formats for best print quality. js Map Generator Give a sentence, get an Illustrator-ready layered SVG and a D3. Download SVG View Source GIS Customize Online as Interactive Map Make this Mexico map interactive and customize it online! Our software turns this static SVG map into a zoomable, clickable, mobile-friendly map like the one below. Give a graf, get an SVG + PNG map. stl See the sidebar for instructions and details. SVG is almost certainly the right image format choice here. Contribute to evanapplegate/map-generator development by creating an account on GitHub. Download your maps in SVG, EPS, or PDF formats for online or print publishing. Use this AI to generate high quality map art, battle maps for D&D photos, story maps, fictitious sci-fi maps, and more. Create icon fonts in seconds! Just drag & drop SVGs onto the character grid and download your spiffy new font. Learn how to design detailed vector maps in Adobe Illustrator for clear, stylish, scalable visuals. Fantasy Map Generator: Instantly create unique fantasy worlds for your TTRPGs and stories. Create memorable products and gifts with an easy to use app. Note that this tool will work well with small areas, such as a neighbourhood. Nov 28, 2020 · Observable is your go-to platform for exploring data and creating expressive data visualizations. Generate world maps, challenge viewpoints and export your vector data! Download free SVG map of any country in the world. Create a custom Map of Asia. general high zoom - area:highway included, general style - works well on scale of junction, neighbourhood, town, maybe also for entire cities laser neighbourhood - depiction of a neighbourhood - generates map designed to be a template for laser-cut 3D tactile maps Topography SVG Generator - generate a free topographic map for your next design! Design gorgeous and lightweight SVG maps with ease Interactive CartoSVG uses SVG elements, which are interactive by nature. Customize your maps with specific areas, scales, and contour types. com. No login required. You can create your own custom SVG maps with open data and software. Design custom terrains, rivers, and cities. Easily convert JPG, PNG, BMP, GIF bitmap images to SVG, EPS, PDF, AI, DXF vector images with real full-color tracing, online or using the desktop app! Almost certainly, they use a scan of a street map, and then pull the roads out by color, and then autotrace, cleaning up where needed. A free, web-optimized, SVG world map using the beautiful Robinson projection. Our versatile and free design maker includes built-in SVG editing features. Turn any images to depth map, 3d relief, 3d suclpture in one click. Browse popular maps or choose a country from the list of province-level maps. to create overlays) you can copy the code underneath the image below and save it as an svg file. Instructions: Click, drag, and scroll on the map below. Download for free blank SVG vector map of Africa and use it in any mapping project. Export as SVG or DXF formats. W h at is Kartograph? Kartograph is a simple and lightweight framework for building interactive map applications without Google Maps or any other mapping service. Plus, Recraft supports both raster and vector image generation. Simple Vector World mapCreate a custom map with Atlist → Atlist is the easy way to create maps with multiple markers. With our mapping software, you can easily create, fully edit and export maps that will make the difference. Download Topo Map Contour Lines as SVG Render elevation contour lines as a topographical map for a region as a downloadable SVG file. From managing stormwater and flood risk to planning your home, driveway, gardens, and solar panels, it simplifies complex decisions so you can design with A fun collection of free SVG generators for gradients, patterns, shapes, textures & cool backgrounds. SkyVector is a free online flight planner. Sep 6, 2016 · A tutorial explaining how to create SVG maps using MapShaper. For free and from anywhere. City Map Generator Create procedural American-style cities right in the browser Launch Generator » Report Bug · Request Feature Twitter · Support the project About the project Create procedural maps Download the map as a . Re-tooled version of the Savvy SVG plasmid map generating program. Make your own custom map of the World, United States, Europe, and 50+ different maps. It is an XML format for representing vector graphics. Key Features Unlimited landmark Aug 23, 2025 · The svgMap. This page documents SVGs in context of OpenStreetMap. Free vector world map in scalable vector graphics (svg) format, with countries and 30° graticule, Miller cylindrical projection. mocnfiokcxcasfelqqzstkfwfgaqhrsyyvtdieyhismqcdykatexvapitkkeorhchthoimppvzqq